SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000270279 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000270279
Domain Number 1 Region: 234-320
Classification Level Classification E-value
Superfamily SH2 domain 2.72e-47
Family SH2 domain 0.000014
Further Details:      
 
Domain Number 2 Region: 10-147
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 6.54e-45
Family N-terminal domain of cbl (N-cbl) 0.00034
Further Details:      
 
Domain Number 3 Region: 326-404
Classification Level Classification E-value
Superfamily RING/U-box 2.5e-40
Family RING finger domain, C3HC4 0.00012
Further Details:      
 
Domain Number 4 Region: 148-233
Classification Level Classification E-value
Superfamily EF-hand 1.6e-38
Family EF-hand modules in multidomain proteins 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000270279   Gene: ENSG00000142273   Transcript: ENST00000270279
Sequence length 474
Comment pep:known chromosome:GRCh37:19:45281126:45303891:1 gene:ENSG00000142273 transcript:ENST00000270279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAH
SRRAAGGGGPGGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLE
GQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAESNKD
VKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQE
GRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA
Download sequence
Identical sequences Q9ULV8
gi|195927027|ref|NP_036248.3| ENSP00000270279 NP_036248.3.87134 NP_036248.3.92137 ENSP00000270279 ENSP00000270279 9606.ENSP00000270279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]