SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000287878 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000287878
Domain Number 1 Region: 258-416
Classification Level Classification E-value
Superfamily CBS-domain pair 2.02e-41
Family CBS-domain pair 0.000000158
Further Details:      
 
Domain Number 2 Region: 421-557
Classification Level Classification E-value
Superfamily CBS-domain pair 4.42e-31
Family CBS-domain pair 0.00000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000287878   Gene: ENSG00000106617   Transcript: ENST00000287878
Sequence length 569
Comment pep:known chromosome:GRCh37:7:151253197:151574210:-1 gene:ENSG00000106617 transcript:ENST00000287878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSS
RKVDSPFGPGSPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKTVFPFSYQESPPRSPRR
MSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY
KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEA
GMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANG
VRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKP
LVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAF
MKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVIN
LAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADS
IVGIISLSDILQALILTPAGAKQKETETE
Download sequence
Identical sequences A0A090N8Q6 A0A2J8RKH9 K7DNG6 Q9UGJ0
ENSPTRP00000047541 ENSP00000287878 NP_057287.2.87134 NP_057287.2.92137 ENSPTRP00000047541 ENSP00000376549 9606.ENSP00000287878 gi|33186925|ref|NP_057287.2| ENSP00000287878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]