SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000291009 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000291009
Domain Number 1 Region: 29-146
Classification Level Classification E-value
Superfamily E set domains 1.25e-36
Family SVA-like 0.000000516
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000291009   Gene: ENSG00000159763   Transcript: ENST00000291009
Sequence length 146
Comment pep:known chromosome:GRCh37:7:142829170:142836839:1 gene:ENSG00000159763 transcript:ENST00000291009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQT
ELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIREL
GICPDDAAVIPIKNNRFYTIEILKVE
Download sequence
Identical sequences P12273
ENSP00000291009 9606.ENSP00000291009 NP_002643.1.87134 NP_002643.1.92137 ENSP00000291009 ENSP00000291009 gi|4505821|ref|NP_002643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]