SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000296125 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000296125
Domain Number 1 Region: 145-456
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.31e-116
Family Transglutaminase core 0.0000000534
Further Details:      
 
Domain Number 2 Region: 5-144
Classification Level Classification E-value
Superfamily E set domains 3.22e-40
Family Transglutaminase N-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 585-683
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.39e-23
Family Transglutaminase, two C-terminal domains 0.0011
Further Details:      
 
Domain Number 4 Region: 473-579
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000178
Family Transglutaminase, two C-terminal domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000296125   Gene: ENSG00000163810   Transcript: ENST00000296125
Sequence length 684
Comment pep:known chromosome:GRCh37:3:44916103:44956482:1 gene:ENSG00000163810 transcript:ENST00000296125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDASKELQVLHIDFLNQDNAVSHHTWEFQTSSPVFRRGQVFHLRLVLNQPLQSYHQLKL
EFSTGPNPSIAKHTLVVLDPRTPSDHYNWQATLQNESGKEVTVAVTSSPNAILGKYQLNV
KTGNHILKSEENILYLLFNPWCKEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWN
FGQFEKNVLDCCISLLTESSLKPTDRRDPVLVCRAMCAMMSFEKGQGVLIGNWTGDYEGG
TAPYKWTGSAPILQQYYNTKQAVCFGQCWVFAGILTTVLRALGIPARSVTGFDSAHDTER
NLTVDTYVNENGEKITSMTHDSVWNFHVWTDAWMKRPDLPKGYDGWQAVDATPQERSQGV
FCCGPSPLTAIRKGDIFIVYDTRFVFSEVNGDRLIWLVKMVNGQEELHVISMETTSIGKN
ISTKAVGQDRRRDITYEYKYPEGSSEERQVMDHAFLLLSSEREHRRPVKENFLHMSVQSD
DVLLGNSVNFTVILKRKTAALQNVNILGSFELQLYTGKKMAKLCDLNKTSQIQGQVSEVT
LTLDSKTYINSLAILDDEPVIRGFIIAEIVESKEIMASEVFTSFQYPEFSIELPNTGRIG
QLLVCNCIFKNTLAIPLTDVKFSLESLGISSLQTSDHGTVQPGETIQSQIKCTPIKTGPK
KFIVKLSSKQVKEINAQKIVLITK
Download sequence
Identical sequences P49221
ENSP00000296125 NP_003232.2.87134 NP_003232.2.92137 gi|156627577|ref|NP_003232.2| ENSP00000296125 ENSP00000296125 9606.ENSP00000296125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]