SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000300215 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000300215
Domain Number 1 Region: 175-483
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.98e-85
Family Transglutaminase core 0.000000738
Further Details:      
 
Domain Number 2 Region: 6-174
Classification Level Classification E-value
Superfamily E set domains 2.48e-44
Family Transglutaminase N-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 617-715
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.06e-28
Family Transglutaminase, two C-terminal domains 0.00083
Further Details:      
 
Domain Number 4 Region: 503-615
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.59e-28
Family Transglutaminase, two C-terminal domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000300215   Gene: ENSG00000166947   Transcript: ENST00000300215
Sequence length 721
Comment pep:known chromosome:GRCh37:15:43487571:43513481:-1 gene:ENSG00000166947 transcript:ENST00000300215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGEPSQRSTGLAGLYAAPAASPVFIKGSGMDALGIKSCDFQAARNNEEHHTKALSSRR
LFVRRGQPFTIILYFRAPVRAFLPALKKVALTAQTGEQPSKINRTQATFPISSLGDRKWW
SAVVEERDAQSWTISVTTPADAVIGHYSLLLQVSGRKQLLLGQFTLLFNPWNREDAVFLK
NEAQRMEYLLNQNGLIYLGTADCIQAESWDFGQFEGDVIDLSLRLLSKDKQVEKWSQPVH
VARVLGALLHFLKEQRVLPTPQTQATQEGALLNKRRGSVPILRQWLTGRGRPVYDGQAWV
LAAVACTVLRCLGIPARVVTTFASAQGTGGRLLIDEYYNEEGLQNGEGQRGRIWIFQTST
ECWMTRPALPQGYDGWQILHPSAPNGGGVLGSCDLVPVRAVKEGTLGLTPAVSDLFAAIN
ASCVVWKCCEDGTLELTDSNTKYVGNNISTKGVGSDRCEDITQNYKYPEGSLQEKEVLER
VEKEKMEREKDNGIRPPSLETASPLYLLLKAPSSLPLRGDAQISVTLVNHSEQEKAVQLA
IGVQAVHYNGVLAAKLWRKKLHLTLSANLEKIITIGLFFSNFERNPPENTFLRLTAMATH
SESNLSCFAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGL
IHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELS
A
Download sequence
Identical sequences ENSP00000300215 NP_000110.2.87134 NP_000110.2.92137 XP_011519651.1.92137 XP_011519652.1.92137 XP_011519653.1.92137 ENSP00000300215 gi|166362735|ref|NP_000110.2| ENSP00000300215 9606.ENSP00000300215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]