SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000301948 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000301948
Domain Number 1 Region: 73-187
Classification Level Classification E-value
Superfamily DNA-binding domain 6.54e-33
Family Methyl-CpG-binding domain, MBD 0.000000724
Further Details:      
 
Weak hits

Sequence:  ENSP00000301948
Domain Number - Region: 200-247
Classification Level Classification E-value
Superfamily E set domains 0.021
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000301948   Gene: ENSG00000169057   Transcript: ENST00000303391
Sequence length 486
Comment pep:known chromosome:GRCh37:X:153287024:153363212:-1 gene:ENSG00000169057 transcript:ENST00000303391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAG
KAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY
DVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPK
APGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGAT
TSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETV
LPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASS
PPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPR
GGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTP
VTERVS
Download sequence
Identical sequences A0A2I2ZDI5 A0A2J8RLQ6 D3YJ43 K7B9T3 P51608
NP_004983.1.87134 NP_004983.1.92137 XP_009438115.1.37143 XP_014199079.1.60992 XP_018874878.1.27298 ENSP00000301948 ENSP00000301948 ENSP00000470011 gi|4826830|ref|NP_004983.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]