SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000305815 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000305815
Domain Number 1 Region: 161-318
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 4.71e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 15-163
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-66
Family DNA-binding protein LAG-1 (CSL) 0.0000107
Further Details:      
 
Domain Number 3 Region: 319-431
Classification Level Classification E-value
Superfamily E set domains 1.12e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000305815   Gene: ENSG00000168214   Transcript: ENST00000345843
Sequence length 485
Comment pep:known chromosome:GRCh37:4:26321332:26432688:1 gene:ENSG00000168214 transcript:ENST00000345843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYL
MGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDK
RKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRS
QTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVT
GMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPK
EPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTG
QNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGII
YSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSST
ATVVS
Download sequence
Identical sequences A0A2I3LNT3 A0A2K5TVU8 A0A2K5YEY9 G3QPJ9 H2R2Q6
NP_976028.1.87134 NP_976028.1.92137 XP_011820739.1.47321 ENSP00000305815 ENSP00000305815 gi|42560225|ref|NP_976028.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]