SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000311399 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000311399
Domain Number 1 Region: 5-152
Classification Level Classification E-value
Superfamily E set domains 0.0000091
Family Arrestin/Vps26-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000311399   Gene: ENSG00000157538   Transcript: ENST00000309117
Sequence length 297
Comment pep:known chromosome:GRCh37:21:38595721:38639833:-1 gene:ENSG00000157538 transcript:ENST00000309117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTALDIKIKRANKVYHAGEVLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFE
AFYNSVKPIQIINSTIEMVKPGKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTL
RCDMKRSLLAKDLTKTCEFIVHSAPQKGKFTPSPVDFTITPETLQNVKERALLPKFLLRG
HLNSTNCVITQPLTGELVVESSEAAIRSVELQLVRVETCGCAEGYARDATEIQNIQIADG
DVCRGLSVPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLLHPDHLITENFPLKLCRI
Download sequence
Identical sequences O14972
ENSP00000311399 NP_006043.1.87134 NP_006043.1.92137 9606.ENSP00000311399 ENSP00000311399 HR58 ENSP00000311399 gi|5174425|ref|NP_006043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]