SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000311538 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000311538
Domain Number 1 Region: 3-172
Classification Level Classification E-value
Superfamily E set domains 8.75e-75
Family Arrestin/Vps26-like 0.000000431
Further Details:      
 
Domain Number 2 Region: 176-366
Classification Level Classification E-value
Superfamily E set domains 7.7e-56
Family Arrestin/Vps26-like 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000311538   Gene: ENSG00000120500   Transcript: ENST00000307959
Sequence length 388
Comment pep:known chromosome:GRCh37:X:69488202:69501690:1 gene:ENSG00000120500 transcript:ENST00000307959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKCRKLFVMLTCAFRYG
RDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNL
PCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPS
AQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVL
YSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASS
TIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAASS
EDIVIEEFTRKGEEESQKAVEAEGDEGS
Download sequence
Identical sequences P36575
ENSP00000311538 NP_004303.2.87134 NP_004303.2.92137 ENSP00000425505 9606.ENSP00000311538 gi|156071467|ref|NP_004303.2| ENSP00000311538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]