SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000315212 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000315212
Domain Number 1 Region: 131-183
Classification Level Classification E-value
Superfamily RING/U-box 1.5e-18
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000315212   Gene: ENSG00000063978   Transcript: ENST00000314289
Sequence length 190
Comment pep:known chromosome:GRCh37:4:2470664:2517582:1 gene:ENSG00000063978 transcript:ENST00000314289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVD
LTHNDSVVIVDERRRPRRNARRLPQDHADSCVVSSDDEELSRDRDVYVTTHTPRNARDEG
ATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKI
NHKRYHPIYI
Download sequence
Identical sequences A0A2I2ZC58 A0A2I3TGK3 P78317
NP_001171938.1.87134 NP_001171938.1.92137 NP_002929.1.87134 NP_002929.1.92137 XP_004038387.1.27298 XP_004038389.1.27298 XP_004038390.1.27298 XP_009445503.2.37143 XP_018880854.1.27298 ENSP00000422619 gi|297139777|ref|NP_001171938.1| gi|4506561|ref|NP_002929.1| ENSGGOP00000014782 9606.ENSP00000315212 ENSP00000315212 ENSP00000424076 ENSP00000426503 ENSGGOP00000014782 ENSP00000315212 ENSP00000424076 ENSP00000426503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]