SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000315386 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000315386
Domain Number 1 Region: 27-132
Classification Level Classification E-value
Superfamily E set domains 0.0000000000514
Family Filamin repeat (rod domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000315386   Gene: ENSG00000178202   Transcript: ENST00000323468
Sequence length 507
Comment pep:known chromosome:GRCh37:11:108342832:108369159:-1 gene:ENSG00000178202 transcript:ENST00000323468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLPRALLLQLRLALLVAAGAPEVLVSAPRSLVWGPGLQAAVVLPVRYFYLQAVNSEGQ
NLTRSPAGETPFKVVVKSLSPKELVRIHVPKPLDRNDGTFLMRYRMYETVDEGLKIEVLY
GDEHVAQSPYILKGPVYHEYCECPEDPQAWQKTLSCPTKEPQIAKDFASFPSINLQQMLK
EVPKRFGDERGAIVHYTILNNHVYRRSLGKYTDFKMFSDEILLSLTRKVLLPDLEFYVNL
GDWPLEHRKVNGTPSPIPIISWCGSLDSRDVVLPTYDITHSMLEAMRGVTNDLLSIQGNT
GPSWINKTERAFFRGRDSREERLQLVQLSKENPQLLDAGITGYFFFQEKEKELGKAKLMG
FFDFFKYKYQVNVDGTVAAYRYPYLMLGDSLVLKQDSPYYEHFYMALEPWKHYVPIKRNL
SDLLEKVKWAKENDEEAKKIAKEGQLMARDLLQPHRLYCYYYQVLQKYAERQSSKPEVRD
GMELVPQPEDSTAICQCHRKKPSREEL
Download sequence
Identical sequences A0A024R3C4 Q7Z4H8
9606.ENSP00000315386 NP_714916.3.87134 NP_714916.3.92137 ENSP00000315386 ENSP00000315386 ENSP00000315386 gi|153218487|ref|NP_714916.3| NYSGRC-IgSF-KDEL2_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]