SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000323194 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000323194
Domain Number 1 Region: 41-507
Classification Level Classification E-value
Superfamily Sema domain 5.49e-131
Family Sema domain 0.0000177
Further Details:      
 
Domain Number 2 Region: 1352-1479,1675-1864
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.68e-52
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 952-1039
Classification Level Classification E-value
Superfamily E set domains 2.68e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 
Domain Number 4 Region: 858-952
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000243
Family Other IPT/TIG domains 0.006
Further Details:      
 
Domain Number 5 Region: 1037-1141
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000216
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 
Domain Number 6 Region: 510-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000157
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 7 Region: 1138-1227
Classification Level Classification E-value
Superfamily E set domains 0.00000134
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Domain Number 8 Region: 809-842
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000785
Family Plexin repeat 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSP00000323194
Domain Number - Region: 654-686
Classification Level Classification E-value
Superfamily Plexin repeat 0.0379
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000323194   Gene: ENSG00000221866   Transcript: ENST00000321063
Sequence length 1894
Comment pep:known chromosome:GRCh37:7:131808091:132261323:-1 gene:ENSG00000221866 transcript:ENST00000321063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAMPWNWTCLLSHLLMVGMGSSTLLTRQPAPLSQKQRSFVTFRGEPAEGFNHLVVDERT
GHIYLGAVNRIYKLSSDLKVLVTHETGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLI
DYKENRLIACGSLYQGICKLLRLEDLFKLGEPYHKKEHYLSGVNESGSVFGVIVSYSNLD
DKLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTIIPDF
DIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGC
ERSGVEYRLLQAAYLSKAGAVLGRTLGVHPDDDLLFTVFSKGQKRKMKSLDESALCIFIL
KQINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSDMVR
GIPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGP
VLRDMAFSKDHEQLYIMSERQLTRVPVESCGQYQSCGECLGSGDPHCGWCVLHNTCTRKE
RCERSKEPRRFASEMKQCVRLTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSE
MDGLVVGNQIQCYSPAAKEVPRIITENGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHN
SCLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKPI
TLKAKNLPQPQSGQRGYECILNIQGSEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPVE
LTVVWNGHFNIDNPAQNKVHLYKCGAMRESCGLCLKADPDFACGWCQGPGQCTLRQHCPA
QESQWLELSGAKSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVE
CSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLK
PSRGPMSGGTQVTITGTNLNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVS
VQVDRAKIHQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGK
EHINICEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYP
NPVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCTVTVSDVQLL
CESPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSLPAIVSIAVAGGLLIIFIVAVLIAY
KRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTY
TMRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSM
RDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTN
WFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTL
VLSCVSPDNANSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSG
ARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNNSTVSRTSASK
YENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLTR
LLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKS
NCLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLY
AKDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIFSYVGKY
SEEILGPLDHDDQCGKQKLAYKLEQVITLMSLDS
Download sequence
Identical sequences A0A024R7A6 Q9HCM2
ENSP00000323194 NYSGRC-157738645 ENSP00000323194 ENSP00000352882 gi|157738645|ref|NP_065962.1| NP_065962.1.87134 NP_065962.1.92137 XP_005250743.1.92137 XP_006716234.1.92137 ENSP00000323194 ENSP00000352882 9606.ENSP00000323194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]