SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000323867 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000323867
Domain Number 1 Region: 26-193
Classification Level Classification E-value
Superfamily CBS-domain pair 3.42e-39
Family CBS-domain pair 0.0000000763
Further Details:      
 
Domain Number 2 Region: 197-333
Classification Level Classification E-value
Superfamily CBS-domain pair 5.09e-33
Family CBS-domain pair 0.0000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000323867   Gene: ENSG00000181929   Transcript: ENST00000316299
Sequence length 340
Comment pep:novel chromosome:GRCh37:12:49396061:49412562:-1 gene:ENSG00000181929 transcript:ENST00000316299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVVLRALSCPLGMLTITDFINILHRYYKSALVQIYELEE
HKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKR
ILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVV
DEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINR
LVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP
Download sequence
Identical sequences NP_001193638.1.87134 NP_001193638.1.92137 ENSP00000447433 ENSP00000323867 ENSP00000323867 gi|332000015|ref|NP_001193638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]