SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000326937 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000326937
Domain Number 1 Region: 409-566
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.4e-20
Family Tandem AAA-ATPase domain 0.0094
Further Details:      
 
Domain Number 2 Region: 559-617
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000658
Family Sec63 C-terminal domain-like 0.000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000326937   Gene: ENSG00000144028   Transcript: ENST00000349783
Sequence length 625
Comment pep:known chromosome:GRCh37:2:96940077:96971297:-1 gene:ENSG00000144028 transcript:ENST00000349783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKIT
DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFL
YQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGS
HFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIY
IAPMRSLVQEMVGSFGKRDAKSNSLISIKRLTLQQKAKVKLDFVAPATGAHNYTLYFMSD
AYMGCDQEYKFSVDVKEAETDSDSD
Download sequence
Identical sequences ENSP00000326937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]