SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000337040 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000337040
Domain Number 1 Region: 58-238
Classification Level Classification E-value
Superfamily CATH 4.8e-141
Family CATH 0.00000000906
Further Details:      
 
Domain Number 2 Region: 78-236
Classification Level Classification E-value
Superfamily E set domains 4.92e-54
Family RhoGDI-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000337040   Gene: ENSG00000109103   Transcript: ENST00000335765
Sequence length 240
Comment pep:known chromosome:GRCh37:17:26873725:26879686:-1 gene:ENSG00000109103 transcript:ENST00000335765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPI
GPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRD
LDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFG
FCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Download sequence
Identical sequences Q13432
GO.35358 HR3066 9606.ENSP00000337040 4goj_C 4goj_D 4gok_C 4gok_G NP_005139.1.87134 NP_005139.1.92137 ENSP00000337040 ENSP00000337040 gi|4827048|ref|NP_005139.1| ENSP00000301032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]