SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000339699 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000339699
Domain Number 1 Region: 163-320
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 4.71e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 17-165
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-66
Family DNA-binding protein LAG-1 (CSL) 0.0000107
Further Details:      
 
Domain Number 3 Region: 321-433
Classification Level Classification E-value
Superfamily E set domains 1.12e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000339699   Gene: ENSG00000168214   Transcript: ENST00000348160
Sequence length 487
Comment pep:known chromosome:GRCh37:4:26322422:26432688:1 gene:ENSG00000168214 transcript:ENST00000348160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVVTGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCV
YLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDS
DKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRL
RSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCS
VTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPC
PKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLEL
TGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDG
IIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTS
STATVVS
Download sequence
Identical sequences A0A2I2Z7A3 A0A2I3MNT7 A0A2J8NVV2 A0A2K5TVV8
ENSP00000339699 NP_056958.3.87134 NP_056958.3.92137 XP_004038553.1.27298 XP_005554686.1.63531 XP_008015900.1.81039 XP_011820737.1.47321 XP_517135.2.37143 ENSP00000339699 gi|42560229|ref|NP_056958.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]