SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000340124 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000340124
Domain Number 1 Region: 162-319
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 4.71e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 16-164
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-66
Family DNA-binding protein LAG-1 (CSL) 0.0000107
Further Details:      
 
Domain Number 3 Region: 320-432
Classification Level Classification E-value
Superfamily E set domains 1.12e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000340124   Gene: ENSG00000168214   Transcript: ENST00000342320
Sequence length 486
Comment pep:known chromosome:GRCh37:4:26364058:26436541:1 gene:ENSG00000168214 transcript:ENST00000342320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVY
LMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSD
KRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLR
SQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSV
TGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCP
KEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELT
GQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGI
IYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSS
TATVVS
Download sequence
Identical sequences A0A096NZL3 A0A2I2YWD2 A0A2I3TAJ2 A0A2K5TVV3 A0A2K5YEZ0 A0A2K6NDI5
ENSPANP00000018534 ENSGGOP00000026907 gi|42560223|ref|NP_976029.1| ENSP00000340124 ENSP00000347659 NP_976029.1.87134 NP_976029.1.92137 XP_001166553.1.37143 XP_004038552.1.27298 XP_005248218.1.92137 XP_005554687.1.63531 XP_005554688.1.63531 XP_005554689.1.63531 XP_008015901.1.81039 XP_008015902.1.81039 XP_011512142.1.92137 XP_011820738.1.47321 XP_015305708.1.63531 XP_016863662.1.92137 XP_016863663.1.92137 XP_016863664.1.92137 XP_018881022.1.27298 XP_018881023.1.27298 ENSP00000340124 ENSP00000347659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]