SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000340753 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000340753
Domain Number 1 Region: 146-253
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000127
Family cAMP-binding domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000340753   Gene: ENSG00000121577   Transcript: ENST00000341124
Sequence length 368
Comment pep:known chromosome:GRCh37:3:119360905:119379491:-1 gene:ENSG00000121577 transcript:ENST00000341124 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSANSSRVGQLLLQGSACIRWKQDVEGAVYHLANCLLLLGFMGGSGVYGCFYLFGFLSAG
YLCCVLWGWFSACGLDIVLWSFLLAVVCLLQLAHLVYRLREDTLPEEFDLLYKTLCLPLQ
VPLQTYKEIVHCCEEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY
QFMDSPEWESLQPSEEGVFQVTLTAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYD
ISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLGPTAADAGPESEKGDEEVCEPAVSPPQAT
PTSLQQTPPCSTPPATTNFPAPPTRARLSRPDSGILGEDSTSLVLEDFEEVSGSESFMDY
RSDGEYMR
Download sequence
Identical sequences C9J3P7
XP_005247755.1.92137 ENSP00000340753 ENSP00000417250 ENSP00000340753 ENSP00000340753 ENSP00000417250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]