SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000341243 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000341243
Domain Number 1 Region: 204-364
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 1.01e-62
Family DNA-binding protein LAG-1 (CSL) 0.00000559
Further Details:      
 
Domain Number 2 Region: 53-206
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.37e-56
Family DNA-binding protein LAG-1 (CSL) 0.0000313
Further Details:      
 
Domain Number 3 Region: 365-477
Classification Level Classification E-value
Superfamily E set domains 1.65e-35
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000341243   Gene: ENSG00000124232   Transcript: ENST00000343694
Sequence length 517
Comment pep:known chromosome:GRCh37:20:43935491:43945803:1 gene:ENSG00000124232 transcript:ENST00000343694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTTILRGGVRRC
LQQQCEQTVRILHAKVAQKSYGNEKRFFCPPPCVYLSGPGWRVKPGQDQAHQAGETGPTV
CGYMGLDSASGSATETQKLNFEQQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGRE
LGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFVA
SARQWAAFTLHLADGHSAQGDFPPREGYVRYGSLVQLVCTVTGITLPPMIIRKVAKQCAL
LDVDEPISQLHKCAFQFPGSPPGGGGTYLCLATEKVVQFQASPCPKEANRALLNDSSCWT
IIGTESVEFSFSTSLACTLEPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDV
EAETMYRSPRSLVCVVPDVAAFCSDWRWLRAPITIPMSLVRADGLFYPSAFSFTYTPEYS
VRPGHPGVPEPATDADALLESIHQEFTRTNFHLFIQT
Download sequence
Identical sequences Q9UBG7
9606.ENSP00000341243 ENSP00000341243 NP_055091.2.87134 NP_055091.2.92137 gi|34577081|ref|NP_055091.2| ENSP00000361828 ENSP00000341243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]