SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000341325 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000341325
Domain Number 1 Region: 43-522
Classification Level Classification E-value
Superfamily Sema domain 3.01e-115
Family Sema domain 0.00000257
Further Details:      
 
Domain Number 2 Region: 1036-1295
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-74
Family Protein kinases, catalytic subunit 0.0000000195
Further Details:      
 
Domain Number 3 Region: 681-769
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000216
Family Other IPT/TIG domains 0.069
Further Details:      
 
Domain Number 4 Region: 522-569
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000628
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 767-861
Classification Level Classification E-value
Superfamily E set domains 0.0000000131
Family Other IPT/TIG domains 0.042
Further Details:      
 
Domain Number 6 Region: 566-621
Classification Level Classification E-value
Superfamily E set domains 0.00000014
Family Other IPT/TIG domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000341325   Gene: ENSG00000164078   Transcript: ENST00000344206
Sequence length 1351
Comment pep:known chromosome:GRCh37:3:49924598:49941042:-1 gene:ENSG00000164078 transcript:ENST00000344206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVT
YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDT
KVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS
PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK
HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC
RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGV
GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSL
NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAW
HFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT
NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN
GTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDPVVLSISPNCG
YINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG
NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEVCVDGECHILGRVVRPG
PDGVPQSTLLGILLPLLLLVAALATALVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLP
ILYSGSDYRSGLALPAIDGLDSTTCVHGASFSDSEDESCVPLLRKESIQLRDLDSALLAE
VKDVLIPHERVVTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQVEAFL
REGLLMRGLNHPNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFG
LQVARSMEYLAEQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARL
PVKWMALESLQTYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQP
EYCPDSLYQVMQQCWEADPAVRPTFRVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSH
EMNVRPEQPQFSPMPGNVRRPRPLSEPPRPT
Download sequence
Identical sequences ENSP00000341325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]