SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000341479 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000341479
Domain Number 1 Region: 173-371
Classification Level Classification E-value
Superfamily E set domains 3.92e-75
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000141
Further Details:      
 
Domain Number 2 Region: 71-189
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000341479   Gene: ENSG00000182324   Transcript: ENST00000342291
Sequence length 436
Comment pep:known chromosome:GRCh37:19:48958766:48969278:1 gene:ENSG00000182324 transcript:ENST00000342291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLARALRRLSGALDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCN
VRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAA
PPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFV
VGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPR
VTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELV
VILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPV
CSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGA
ASPRVLTPTLALTLPP
Download sequence
Identical sequences Q9UNX9
ENSGGOP00000013120 ENSP00000341479 ENSGGOP00000013120 9606.ENSP00000341479 NP_037480.1.87134 NP_037480.1.92137 ENSP00000341479 ENSP00000375756 ENSP00000341479 ENSP00000375756 gi|25777635|ref|NP_733838.1| gi|7019439|ref|NP_037480.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]