SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000341877 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000341877
Domain Number 1 Region: 185-286
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.23e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000571
Further Details:      
 
Domain Number 2 Region: 37-99
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000262
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000341877   Gene: ENSG00000124440   Transcript: ENST00000339613
Sequence length 613
Comment pep:known chromosome:GRCh37:19:46801659:46846690:1 gene:ENSG00000124440 transcript:ENST00000339613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTISYLRMHRLCAAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKH
LGLSQLELIGHSIFDFIHPCDQEELQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRG
RTLNLKAATWKVLNCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPL
GRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSK
GQAVTGQYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISQVEETGVVLSLEQT
EQHSRRPIQRGAPSQKDTPNPGDSLDTPGPRILAFLHPPSLSEAALAADPRRFCSPDLRR
LLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDL
DIAQDADALDLEMLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALE
PSLLPRWGSDPRLSCSSPSRGDPSASSPMAGARKRTLAQSSEDEDEGVELLGVRPPKRSP
SPEHENFLLFPLSLSFLLTGGPAPGSLQDPSTPLLNLNEPLGLGPSLLSPYSDEDTTQPG
GPFQPRAGSAQAD
Download sequence
Identical sequences ENSP00000341877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]