SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000342438 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000342438
Domain Number 1 Region: 132-489
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 1.06e-114
Family Inosine monophosphate dehydrogenase (IMPDH) 0.000000000112
Further Details:      
 
Domain Number 2 Region: 19-86
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 1.46e-16
Family Inosine monophosphate dehydrogenase (IMPDH) 0.0000342
Further Details:      
 
Weak hits

Sequence:  ENSP00000342438
Domain Number - Region: 90-141
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00012
Family CBS-domain pair 0.0000902
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000342438   Gene: ENSG00000106348   Transcript: ENST00000343214
Sequence length 489
Comment pep:known chromosome:GRCh37:7:128032355:128050027:-1 gene:ENSG00000106348 transcript:ENST00000343214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKIT
LKTPLISSPMDTVTEADMAIAMAKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPIT
ETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSK
KGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQ
AGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGM
GCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVM
MGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSG
SIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHG
LHSYEKRLY
Download sequence
Identical sequences NP_001136047.1.87134 NP_001136047.1.92137 gi|217035150|ref|NP_001136047.1| ENSP00000420803 ENSP00000342438 ENSP00000420803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]