SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000344002 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000344002
Domain Number 1 Region: 15-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-79
Family Calponin-homology domain, CH-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 1327-1439
Classification Level Classification E-value
Superfamily E set domains 1.53e-35
Family Filamin repeat (rod domain) 0.0000196
Further Details:      
 
Domain Number 3 Region: 1517-1635
Classification Level Classification E-value
Superfamily E set domains 2.87e-35
Family Filamin repeat (rod domain) 0.00000286
Further Details:      
 
Domain Number 4 Region: 1441-1550
Classification Level Classification E-value
Superfamily E set domains 3.4e-33
Family Filamin repeat (rod domain) 0.0000184
Further Details:      
 
Domain Number 5 Region: 451-569
Classification Level Classification E-value
Superfamily E set domains 1.47e-31
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 6 Region: 1822-1916
Classification Level Classification E-value
Superfamily E set domains 8.01e-31
Family Filamin repeat (rod domain) 0.00000326
Further Details:      
 
Domain Number 7 Region: 1142-1246
Classification Level Classification E-value
Superfamily E set domains 1.87e-30
Family Filamin repeat (rod domain) 0.0000501
Further Details:      
 
Domain Number 8 Region: 2006-2099
Classification Level Classification E-value
Superfamily E set domains 2.5e-30
Family Filamin repeat (rod domain) 0.0000177
Further Details:      
 
Domain Number 9 Region: 667-774
Classification Level Classification E-value
Superfamily E set domains 3.2e-30
Family Filamin repeat (rod domain) 0.00045
Further Details:      
 
Domain Number 10 Region: 1238-1349
Classification Level Classification E-value
Superfamily E set domains 7.34e-30
Family Filamin repeat (rod domain) 0.0000163
Further Details:      
 
Domain Number 11 Region: 1060-1151
Classification Level Classification E-value
Superfamily E set domains 8.01e-30
Family Filamin repeat (rod domain) 0.00000971
Further Details:      
 
Domain Number 12 Region: 749-866
Classification Level Classification E-value
Superfamily E set domains 6.61e-28
Family Filamin repeat (rod domain) 0.0008
Further Details:      
 
Domain Number 13 Region: 855-966
Classification Level Classification E-value
Superfamily E set domains 1.93e-27
Family Filamin repeat (rod domain) 0.0005
Further Details:      
 
Domain Number 14 Region: 2279-2370
Classification Level Classification E-value
Superfamily E set domains 4.67e-27
Family Filamin repeat (rod domain) 0.00000655
Further Details:      
 
Domain Number 15 Region: 2601-2691
Classification Level Classification E-value
Superfamily E set domains 1.47e-26
Family Filamin repeat (rod domain) 0.00000305
Further Details:      
 
Domain Number 16 Region: 273-369
Classification Level Classification E-value
Superfamily E set domains 1.27e-25
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 17 Region: 559-660
Classification Level Classification E-value
Superfamily E set domains 1.27e-25
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 18 Region: 1624-1736
Classification Level Classification E-value
Superfamily E set domains 1.93e-25
Family Filamin repeat (rod domain) 0.0000644
Further Details:      
 
Domain Number 19 Region: 373-472
Classification Level Classification E-value
Superfamily E set domains 3.27e-25
Family Filamin repeat (rod domain) 0.00079
Further Details:      
 
Domain Number 20 Region: 2470-2562
Classification Level Classification E-value
Superfamily E set domains 6.67e-25
Family Filamin repeat (rod domain) 0.00000308
Further Details:      
 
Domain Number 21 Region: 2377-2467
Classification Level Classification E-value
Superfamily E set domains 2.47e-23
Family Filamin repeat (rod domain) 0.00000441
Further Details:      
 
Domain Number 22 Region: 953-1054
Classification Level Classification E-value
Superfamily E set domains 1.67e-21
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 23 Region: 2212-2293
Classification Level Classification E-value
Superfamily E set domains 7.34e-20
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 24 Region: 1924-2020
Classification Level Classification E-value
Superfamily E set domains 5.4e-18
Family Filamin repeat (rod domain) 0.0000946
Further Details:      
 
Domain Number 25 Region: 1760-1838
Classification Level Classification E-value
Superfamily E set domains 8.67e-17
Family Filamin repeat (rod domain) 0.0000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000344002   Gene: ENSG00000128591   Transcript: ENST00000346177
Sequence length 2692
Comment pep:known chromosome:GRCh37:7:128470480:128499328:1 gene:ENSG00000128591 transcript:ENST00000346177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDL
QRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSK
AIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITN
FNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEI
VDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTV
QTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIE
RSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGR
RDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRAS
GRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPV
VPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTE
VGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILP
APPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIP
NGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLK
ANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGR
YTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKA
KLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNV
APPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGG
AEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTP
APFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHI
PGSPFKATIRPVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKA
EVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGV
EPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYE
EGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGT
GGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDV
VDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGT
HTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPV
EFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDE
IPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTC
TVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLATEEPVV
PVEPMESMLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGL
HQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLS
LAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMR
TSQLNVGTSTDVSLKITESDLSQLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEH
VVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGG
LGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGR
MKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEI
SKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQ
VTSPSGKVEAAEIVEGEDSAYSVRFVPQEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGG
AHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSY
VVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTSLQETGLKVNQPASFAVQL
NGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFK
IRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCR
ECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVET
VTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVH
GPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP
Download sequence
Identical sequences ENSP00000344002 ENSP00000344002 gi|188595687|ref|NP_001120959.1| NP_001120959.1.87134 NP_001120959.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]