SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000344158 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000344158
Domain Number 1 Region: 158-210
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000129
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 2 Region: 52-115
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000114
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000344158   Gene: ENSG00000151322   Transcript: ENST00000341321
Sequence length 257
Comment pep:known chromosome:GRCh37:14:33408459:34149849:1 gene:ENSG00000151322 transcript:ENST00000341321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTKPSFQQDPSRRERITAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAA
RSRRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEG
PPPNTSVKVIGAQRRRSPSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSI
YLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSE
TPEPVVCFPPASDQFLL
Download sequence
Identical sequences ENSP00000344158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]