SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000344330 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000344330
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000792
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000344330   Gene: ENSG00000115325   Transcript: ENST00000340004
Sequence length 177
Comment pep:putative chromosome:GRCh37:2:74781858:74784678:1 gene:ENSG00000115325 transcript:ENST00000340004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGSSSGGGRGSSRRL
DCKVIRLAECVSVAPVTVETPPEPGATAFRLDTAQRSHLLAADAPSSAAWVQTLCRNAFP
KGSWTLAPTDNPPKLSALEMLENSLYSPTWEGHVLFRGRPPLPLRPWNLHLPDGTGK
Download sequence
Identical sequences NP_001305797.1.87134 NP_001305797.1.92137 ENSP00000344330 ENSP00000344330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]