SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000344942 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000344942
Domain Number 1 Region: 86-247
Classification Level Classification E-value
Superfamily E set domains 1.96e-54
Family RhoGDI-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000344942   Gene: ENSG00000175970   Transcript: ENST00000344651
Sequence length 251
Comment pep:known chromosome:GRCh37:12:121148238:121161443:1 gene:ENSG00000175970 transcript:ENST00000344651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQ
ELLALDTIRPEHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSD
QEEDEEEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFRE
HLLKNFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMH
NKADYAYNGGQ
Download sequence
Identical sequences A0A096NQM7 A0A0D9S4L2 A0A2K5KQW1 A0A2K5X4B7 A0A2K6DZ95 A0A2K6LGL3 A6NIH7 F7IL48 H2Q718 I0FGY1
ENSP00000344942 ENSCJAP00000002329 ENSP00000344942 ENSPTRP00000009409 ENSCJAP00000002329 NP_001074002.1.87134 NP_001074002.1.92137 NP_001253411.1.72884 XP_001162824.1.37143 XP_002753139.1.60252 XP_003832429.1.60992 XP_005572472.1.63531 XP_008003157.1.81039 XP_011761638.1.29376 XP_011926536.1.92194 XP_017727596.1.44346 ENSPTRP00000009409 ENSP00000344942 ENSPANP00000015339 gi|122937500|ref|NP_001074002.1| 9598.ENSPTRP00000009409 9606.ENSP00000344942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]