SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000345646 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345646
Domain Number 1 Region: 523-853
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.39e-106
Family PDEase 0.00000126
Further Details:      
 
Domain Number 2 Region: 255-356
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.18e-17
Family Flavin-binding PAS domain 0.05
Further Details:      
 
Weak hits

Sequence:  ENSP00000345646
Domain Number - Region: 129-201
Classification Level Classification E-value
Superfamily CheY-like 0.00131
Family CheY-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345646   Gene: ENSG00000113231   Transcript: ENST00000342343
Sequence length 865
Comment pep:known chromosome:GRCh37:5:76506751:76722458:1 gene:ENSG00000113231 transcript:ENST00000342343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCAPSIHVSQSGVIYCRDSDESSSPRQTTSVSQGPAAPLPGLFVQTDAADAIPPSRASG
PPSVARVRRARTELGSGSSAGSAAPAATTSRGRRRHCCSSAEAETQTCYTSVKVLLIFAK
EDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRQTQNFDAEAVCRSIR
ATNPSEHTVILAVVSRVSDDHEEASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVR
SQFKLRACNSVFTALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKS
DKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVKITPVIGQGGKIRHFVSLKKL
CCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPS
MARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTELYSPQLGTKDEDPH
TSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHLAMPITINDVPPCISQLLDNEESWDFN
IFELEAITHKRPLVYLGLKVFSRFGVCEFLNCSETTLRAWFQVIEANYHSSNAYHNSTHA
ADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYND
TAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFV
NSINKPMAAEIEGSDCECNPAGKNFPENQILIKRMMIKCADVANPCRPLDLCIEWAGRIS
EEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFAHLPALMQH
LADNYKHWKTLDDLKCKSLRLPSDS
Download sequence
Identical sequences ENSP00000345646 gi|71164873|ref|NP_001025024.1| NP_001025024.1.87134 NP_001025024.1.92137 ENSP00000345646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]