SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000345708 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345708
Domain Number 1 Region: 156-352
Classification Level Classification E-value
Superfamily E set domains 2.47e-71
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000266
Further Details:      
 
Domain Number 2 Region: 48-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-22
Family Voltage-gated potassium channels 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345708   Gene: ENSG00000187486   Transcript: ENST00000339994
Sequence length 390
Comment pep:known chromosome:GRCh37:11:17407406:17410206:-1 gene:ENSG00000187486 transcript:ENST00000339994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRKGIIPEEYVLTRLAEDPAKPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDHSLLEALT
LASARGPLRKRSVPMAKAKPKFSISPDSLS
Download sequence
Identical sequences B2RC52
gi|62388888|ref|NP_000516.3| 9606.ENSP00000345708 ENSP00000345708 ENSP00000345708 ENSP00000345708 NP_000516.3.87134 NP_000516.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]