SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345838 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345838
Domain Number 1 Region: 20-136
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.34e-16
Family Nucleotide and nucleoside kinases 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345838   Gene: ENSG00000139597   Transcript: ENST00000343281
Sequence length 163
Comment pep:putative chromosome:GRCh37:13:32977816:33002151:-1 gene:ENSG00000139597 transcript:ENST00000343281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRPPRPPPRGTPPRRHSFRKHLYLLRGLPGSGKTTLARQLQHDFPRALIFSTDDFFFRED
GAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTNLHAWEMKPYAVMALENNYEVIF
REPDTRWKFNVQELARQIVSSKWICGLLHQNCLRWLLKSEFMD
Download sequence
Identical sequences ENSP00000345838 ENSP00000345838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]