SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000347463 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000347463
Domain Number 1 Region: 263-346
Classification Level Classification E-value
Superfamily E set domains 6.16e-20
Family E-set domains of sugar-utilizing enzymes 0.09
Further Details:      
 
Weak hits

Sequence:  ENSP00000347463
Domain Number - Region: 353-403
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0125
Family HLH, helix-loop-helix DNA-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000347463   Gene: ENSG00000108001   Transcript: ENST00000355311
Sequence length 596
Comment pep:known chromosome:GRCh37:10:131635064:131762105:-1 gene:ENSG00000108001 transcript:ENST00000355311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQENIPRGGTTMKEEPLGSGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPS
NLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGV
RTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDP
VIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKH
GRRARRLDPSEGTAPSYLENATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTML
VWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRL
QKVIPRHPGDPERLPKEVLLKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHN
QIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQ
SNYNTVSTSMNGYGSGAMASLGVPGSPGFLNGSSANSPYGIVPSSPTMAASSVTLPSNCS
STHGIFSFSPANVISAVKQKSAFAPVVRPQASPPPSCTSANGNGLQAMSGLVVPPM
Download sequence
Identical sequences A0A2J8KEE5 Q9H4W6
ENSP00000347463 XP_003312875.1.37143 XP_005252725.1.92137 9598.ENSPTRP00000046077 ENSP00000347463 ENSP00000347463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]