SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000348440 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000348440
Domain Number 1 Region: 173-419
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 3.92e-81
Family Oxidoreductase molybdopterin-binding domain 0.00000001
Further Details:      
 
Domain Number 2 Region: 422-543
Classification Level Classification E-value
Superfamily E set domains 3.78e-39
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.00000552
Further Details:      
 
Domain Number 3 Region: 83-165
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 4.84e-21
Family Cytochrome b5 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000348440   Gene: ENSG00000139531   Transcript: ENST00000356124
Sequence length 545
Comment pep:known chromosome:GRCh37:12:56390964:56399309:1 gene:ENSG00000139531 transcript:ENST00000356124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLHRAVVLRLQQACRLKSIPSRICIQACSTNDSFQPQRPSLTFSGDNSSTQGWRVMGT
LLGLGAVLAYQDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPG
GPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYADDP
VRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGG
QSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCD
VLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRD
HGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSI
QELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQ
RPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVH
VYVSP
Download sequence
Identical sequences A0A024RB79 P51687
9606.ENSP00000266971 ENSP00000266971 ENSP00000348440 ENSP00000377668 ENSP00000377674 ENSP00000450245 ENSP00000450264 gi|74099694|ref|NP_000447.2| gi|74099702|ref|NP_001027558.1| gi|74099704|ref|NP_001027559.1| HR6808 ENSP00000266971 ENSP00000348440 ENSP00000377668 ENSP00000377674 ENSP00000450245 ENSP00000450264 ENSP00000266971 NP_000447.2.87134 NP_000447.2.92137 NP_001027558.1.87134 NP_001027558.1.92137 NP_001027559.1.87134 NP_001027559.1.92137 XP_016875396.1.92137 XP_016875397.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]