SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000348714 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000348714
Domain Number 1 Region: 449-816
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 9.02e-104
Family Hect, E3 ligase catalytic domain 0.0000035
Further Details:      
 
Domain Number 2 Region: 67-172
Classification Level Classification E-value
Superfamily E set domains 0.00000000173
Family Filamin repeat (rod domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000348714   Gene: ENSG00000119682   Transcript: ENST00000356357
Sequence length 823
Comment pep:known chromosome:GRCh37:14:75127955:75179818:-1 gene:ENSG00000119682 transcript:ENST00000356357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYVIGGITVSVVAFFFTIKFLFELAARVVSFLQNEDRERRGDRTIYDYVRGNYLDPRSC
KVSWDWKDPYEVGHSMAFRVHLFYKNGQPFPAHRPVGLRVHISHVELAVEIPVTQEVLQE
PNSNVVKVAFTVRKAGRYEITVKLGGLNVAYSPYYKIFQPGMVVPSKTKIVCHFSTLVLT
CGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGVSFEKSVTSNRQT
FQVFLRLTLHSRGCFHACISYQNQPINNGEFDIIVLSEDEKNIVERNVSTSGVSIYFEAY
LYNATNCSSTPWHLPPMHMTSSQRRPSTAVDEEDEDSPSECHTPEKVKKPKKVYCYVSPK
QFSVKEFYLKIIPWRLYTFRVCPGTKFSYLGPDPVHKLLTLVVDDGIQPPVELSCKERNI
LAATFIRSLHKNIGGSETFQDKVNFFQRELRQVHMKRPHSKVTLKVSRHALLESSLKATR
NFSISDWSKNFEVVFQDEEALDWGGPRREWFELICKALFDTTNQLFTRFSDNNQALVHPN
PNRPAHLRLKMYEFAGRLVGKCLYESSLGGAYKQLVRARFTRSFLAQIIGLRMHYKYFET
DDPEFYKSKVCFILNNDMSEMELVFAEEKYNKSGQLDKVVELMTGGAQTPVTNANKIFYL
NLLAQYRLASQVKEEVEHFLKGLNELVPENLLAIFDENELELLMCGTGDISVSDFKAHAV
VVGGSWHFREKVMRWFWTVVSSLTQEELARLLQFTTGSSQLPPGGFAALCPSFQIIAAPT
HSTLPTAHTCFNQLCLPTYDSYEEVHRMLQLAISEGCEGFGML
Download sequence
Identical sequences A0A096N5G7 A0A2K5L5M2 A0A2K5U585 A0A2K5XKP5 A0A2K6BTP7 H9YVJ3 O15033
ENSP00000348714 ENSMMUP00000011650 NYSGRC-87116668 gi|87116668|ref|NP_001034568.1| 9544.ENSMMUP00000011650 9606.ENSP00000348714 ENSP00000348714 NP_001034568.1.87134 NP_001034568.1.92137 NP_001247839.1.72884 XP_005561828.1.63531 XP_011535717.1.92137 XP_011763878.1.29376 XP_011763879.1.29376 XP_011836917.1.47321 XP_011836919.1.47321 XP_011926245.1.92194 XP_014999600.1.72884 XP_014999601.1.72884 XP_015309484.1.63531 XP_015309485.1.63531 ENSMMUP00000011650 ENSP00000348714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]