SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000351075 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351075
Domain Number 1 Region: 723-780
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.89e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 28-70
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000235
Family Somatomedin B domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSP00000351075
Domain Number - Region: 64-137
Classification Level Classification E-value
Superfamily E set domains 0.00042
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351075   Gene: ENSG00000099994   Transcript: ENST00000358321
Sequence length 822
Comment pep:known chromosome:GRCh37:22:24577227:24585078:1 gene:ENSG00000099994 transcript:ENST00000358321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPALLPWALLLLATALGPGPGPTADAQESCSMRCGALDGPCSCHPTCSGLGTCCLDFRD
FCLEILPYSGSMMGGKDFVVRHFKMSSPTDASVICRFKDSIQTLGHVDSSGQVHCVSPLL
YESGRIPFTVSLDNGHSFPRAGTWLAVHPNKVSMMEKSELVNETRWQYYGTANTSGNLSL
TWHVKSLPTQTITIELWGYEETGMPYSQEWTAKWSYLYPLATHIPNSGSFTFTPKPAPPS
YQRWRVGALRIIDSKNYAGQKDVQALWTNDHALAWHLSDDFREDPVAWARTQCQAWEELE
DQLPNFLEELPDCPCTLTQARADSGRFFTDYGCDMEQGSVCTYHPGAVHCVRSVQASLRY
GSGQQCCYTADGTQLLTADSSGGSTPDRGHDWGAPPFRTPPRVPSMSHWLYDVLSFYYCC
LWAPDCPRYMQRRPSNDCRNYRPPRLASAFGDPHFVTFDGTNFTFNGRGEYVLLEAALTD
LRVQARAQPGTMSNGTETRGTGLTAVAVQEGNSDVVEVRLANRTGGLEVLLNQEVLSFTE
QSWMDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLN
NDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPT
FEPLFPSETTLNPSLAQEAAKLCGDDHFCNFDVAATGSLSTGTATRVAHQLHQRRMQSLQ
PVVSCGWLAPPPNGQKEGNRYLAGSTIYFHCDNGYSLAGAETSTCQADGTWSSPTPKCQP
GRSYAVLLGIIFGGLAVVAAVALVYVLLRRRKGNTHVWGAQP
Download sequence
Identical sequences A0A140VJW3 Q9UGT4
NP_062547.1.87134 NP_062547.1.92137 gi|10092665|ref|NP_062547.1| ENSP00000351075 ENSP00000351075 ENSP00000351075 NYSGRC-10092665 9606.ENSP00000351075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]