SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000351242 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351242
Domain Number 1 Region: 28-479
Classification Level Classification E-value
Superfamily Sema domain 3.92e-116
Family Sema domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1418-1545,1733-1919
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.69e-46
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 884-979
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000233
Family Other IPT/TIG domains 0.0085
Further Details:      
 
Domain Number 4 Region: 976-1066
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000196
Family Other IPT/TIG domains 0.037
Further Details:      
 
Domain Number 5 Region: 482-533
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000196
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1066-1110,1140-1193
Classification Level Classification E-value
Superfamily E set domains 0.0000000000243
Family Other IPT/TIG domains 0.048
Further Details:      
 
Weak hits

Sequence:  ENSP00000351242
Domain Number - Region: 638-670
Classification Level Classification E-value
Superfamily Plexin repeat 0.0122
Family Plexin repeat 0.0081
Further Details:      
 
Domain Number - Region: 843-884
Classification Level Classification E-value
Superfamily Plexin repeat 0.0227
Family Plexin repeat 0.0037
Further Details:      
 
Domain Number - Region: 1208-1259
Classification Level Classification E-value
Superfamily E set domains 0.0857
Family E-set domains of sugar-utilizing enzymes 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351242   Gene: ENSG00000164050   Transcript: ENST00000358459
Sequence length 1952
Comment pep:known chromosome:GRCh37:3:48445262:48470872:-1 gene:ENSG00000164050 transcript:ENST00000358459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSP
GLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCE
QRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQ
SRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSA
APPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDV
NSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAF
LGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVA
SCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLP
RGADYVSVSVELRFGAVVIAKTSLSFYDCVAVTELRPSAQCQACVSSRWGCNWCVWQHLC
THKASCDAGPMVASHQSPLVSPDPPARGDGDSAELEGPPAPLILPSSLDYQYDTPGLWEL
EEATLGASSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELEGLEVVV
EARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLYDCS
VGHGDCSRCQTAMPQYGCVWCEGERPRCVTREACGEAEAVATQCPAPLIHSVEPLTGPVD
GGTRVTIRGSNLGQHVQDVLGMVTVAGVPCAVDAQEYEVSSSLVCITGASGEEVAGATAV
EVPGRGRGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTGRLEDIRVVVGDQP
CHLLPEQQSEQLRCETSPRPTPATLPVAVWFGATERRLQRGQFKYTLDPNITSAGPTKSF
LSGGREICVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSSQQF
EEPCHVNSSQLITCRTPALPGLPEDPWVRVEFILDNLVFDFATLNPTPFSYEADPTLQPL
NPEDPTMPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPPVEQ
PLPRHHALREAPDSLPEFTVQMGNLRFSLGHVQYDGESPGAFPVAAQVGLGVGTSLLALG
VIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLGSGI
PFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFIHTL
ESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTETVV
EKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLRED
VEYRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTL
DVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQD
YVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYLTRLL
SMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPL
RFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYARDIP
RYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKYINKYYDQII
TALEEDGTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences ENSP00000414199 ENSP00000351242 ENSP00000414199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]