SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000352354 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000352354
Domain Number 1 Region: 53-307
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.9e-31
Family G proteins 0.046
Further Details:      
 
Domain Number 2 Region: 443-531
Classification Level Classification E-value
Superfamily EF-hand 1.64e-22
Family Eps15 homology domain (EH domain) 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000352354   Gene: ENSG00000110047   Transcript: ENST00000359393
Sequence length 534
Comment pep:known chromosome:GRCh37:11:64620203:64647149:-1 gene:ENSG00000110047 transcript:ENST00000359393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPM
VLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRR
PFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAE
RVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSL
GKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKR
ARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQ
ELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQVVKGGAFDGTMNG
PFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTV
LGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE
Download sequence
Identical sequences A0A0D9R4X7 A0A2I3GDQ0 A0A2J8TYX8 A0A2K5K738 A0A2K5V3A9 A0A2K5YJB5 A0A2K6BUK3 A0A2K6M411 A0A2K6NR76 B0CM69 B2R5U3 G7NCH3 K7CDF0 Q5RBP4 Q9H4M9
ENSPTRP00000006637 gi|30240932|ref|NP_006786.2| ENSNLEP00000006518 ENSNLEP00000006518 ENSPPYP00000003578 ENSP00000320516 ENSP00000352354 ENSP00000320516 ENSPANP00000006208 NP_001125465.1.23681 NP_001248124.1.72884 NP_001269373.1.87134 NP_001269373.1.92137 NP_006786.2.87134 NP_006786.2.92137 XP_003274216.1.23891 XP_007991518.1.81039 XP_008952266.1.60992 XP_008952267.1.60992 XP_008952268.1.60992 XP_009421665.1.37143 XP_009421666.1.37143 XP_010362274.1.97406 XP_011543041.1.92137 XP_011719014.1.29376 XP_011719015.1.29376 XP_011797946.1.43180 XP_011848910.1.47321 XP_014969250.1.72884 XP_015289987.1.63531 XP_016775410.1.37143 XP_017748784.1.44346 XP_017748790.1.44346 ENSPTRP00000006637 ENSPPYP00000003578 ENSMMUP00000005300 ENSP00000320516 ENSP00000352354 9544.ENSMMUP00000005300 9600.ENSPPYP00000003578 9606.ENSP00000320516 ENSMMUP00000005300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]