SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000353124 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000353124
Domain Number 1 Region: 6-175
Classification Level Classification E-value
Superfamily E set domains 1.05e-82
Family Arrestin/Vps26-like 0.0000000217
Further Details:      
 
Domain Number 2 Region: 177-385
Classification Level Classification E-value
Superfamily E set domains 8.4e-73
Family Arrestin/Vps26-like 0.00000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000353124   Gene: ENSG00000137486   Transcript: ENST00000360025
Sequence length 410
Comment pep:known chromosome:GRCh37:11:74976643:75062749:-1 gene:ENSG00000137486 transcript:ENST00000360025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKEEPPHREVPEN
ETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
Download sequence
Identical sequences A0A2I2ZB40 A0A2J8V165 K7D7I3
NP_064647.1.87134 NP_064647.1.92137 XP_004051869.1.27298 XP_016777107.1.37143 ENSP00000353124 ENSP00000353124 gi|10880134|ref|NP_064647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]