SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000353415 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000353415
Domain Number 1 Region: 242-369
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.47e-56
Family cAMP-binding domain 0.0000337
Further Details:      
 
Domain Number 2 Region: 105-237
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.79e-53
Family cAMP-binding domain 0.0000224
Further Details:      
 
Domain Number 3 Region: 15-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.76e-18
Family SCOPe 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000353415   Gene: ENSG00000188191   Transcript: ENST00000360274
Sequence length 381
Comment pep:known chromosome:GRCh37:7:589387:752209:-1 gene:ENSG00000188191 transcript:ENST00000360274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKE
ENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQG
EVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTA
SVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSEILKRNIQRYNSFISLTV
Download sequence
Identical sequences P31321
gi|258613969|ref|NP_001158230.1| gi|258613971|ref|NP_001158231.1| gi|258613973|ref|NP_001158232.1| gi|258613975|ref|NP_001158234.1| gi|258613977|ref|NP_001158233.1| gi|38257139|ref|NP_002726.1| 9606.ENSP00000353415 4din_B ENSP00000353415 ENSP00000353415 ENSP00000385349 ENSP00000385749 ENSP00000440449 ENSP00000444487 ENSP00000353415 ENSP00000385349 ENSP00000385749 ENSP00000440449 ENSP00000444487 NP_001158230.1.87134 NP_001158230.1.92137 NP_001158231.1.87134 NP_001158231.1.92137 NP_001158232.1.87134 NP_001158232.1.92137 NP_001158233.1.87134 NP_001158233.1.92137 NP_001158234.1.87134 NP_001158234.1.92137 NP_002726.1.87134 NP_002726.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]