SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000355330 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355330
Domain Number 1 Region: 146-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.89e-127
Family Transglutaminase core 0.00000000000774
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 2.06e-43
Family Transglutaminase N-terminal domain 0.000000238
Further Details:      
 
Domain Number 3 Region: 470-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.71e-33
Family Transglutaminase, two C-terminal domains 0.000000454
Further Details:      
 
Domain Number 4 Region: 586-686
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.1e-28
Family Transglutaminase, two C-terminal domains 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355330   Gene: ENSG00000198959   Transcript: ENST00000361475
Sequence length 687
Comment pep:known chromosome:GRCh37:20:36756863:36793774:-1 gene:ENSG00000198959 transcript:ENST00000361475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA
Download sequence
Identical sequences P21980 V9HWG3
ENSP00000355330 NP_001310245.1.87134 NP_001310245.1.92137 NP_004604.2.87134 NP_004604.2.92137 XP_008964627.1.60992 XP_011527330.1.92137 ENSP00000355330 ENSP00000355330 gi|39777597|ref|NP_004604.2| 9606.ENSP00000355330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]