SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000355378 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355378
Domain Number 1 Region: 46-471
Classification Level Classification E-value
Superfamily Sema domain 3.01e-100
Family Sema domain 0.00031
Further Details:      
 
Domain Number 2 Region: 1369-1495,1690-1841
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-40
Family p120GAP domain-like 0.045
Further Details:      
 
Domain Number 3 Region: 924-1013
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000292
Family Other IPT/TIG domains 0.022
Further Details:      
 
Domain Number 4 Region: 832-927
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000747
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 474-526
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000116
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1012-1056,1094-1147
Classification Level Classification E-value
Superfamily E set domains 0.000000229
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.06
Further Details:      
 
Domain Number 7 Region: 1161-1242
Classification Level Classification E-value
Superfamily E set domains 0.0000451
Family E-set domains of sugar-utilizing enzymes 0.042
Further Details:      
 
Weak hits

Sequence:  ENSP00000355378
Domain Number - Region: 629-660
Classification Level Classification E-value
Superfamily Plexin repeat 0.0453
Family Plexin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355378   Gene: ENSG00000198753   Transcript: ENST00000361971
Sequence length 1909
Comment pep:known chromosome:GRCh37:X:153029711:153044796:1 gene:ENSG00000198753 transcript:ENST00000361971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHAAQETPLLHHFMAPVMARWPPFGLCLLLLLLSPPPLPLTGAHRFSAPNTTLNHLALA
PGRGTLYVGAVNRLFQLSPELQLEAVAVTGPVIDSPDCVPFRDPAECPQAQLTDNANQLL
LVSSRAQELVACGQVRQGVCETRRLGDVAEVLYQAEDPGDGQFVAANTPGVATVGLVVPL
PGRDLLLVARGLAGKLSAGVPPLAIRQLAGSQPFSSEGLGRLVVGDFSDYNNSYVGAFAD
ARSAYFVFRRRGARAQAEYRSYVARVCLGDTNLYSYVEVPLACQGQGLIQAAFLAPGTLL
GVFAAGPRGTQAALCAFPMVELGASMEQARRLCYTAGGRGPSGAEEATVEYGVTSRCVTL
PLDSPESYPCGDEHTPSPIAGRQPLEVQPLLKLGQPVSAVAALQADGHMIAFLGDTQGQL
YKVFLHGSQGQVYHSQQVGPPGSAISPDLLLDSSGSHLYVLTAHQVDRIPVAACPQFPDC
ASCLQAQDPLCGWCVLQGRCTRKGQCGRAGQLNQWLWSYEEDSHCLHIQSLLPGHHPRQE
QGQVTLSVPRLPILDADEYFHCAFGDYDSLAHVEGPHVACVTPPQDQVPLNPPGTDHVTV
PLALMFEDVTVAATNFSFYDCSAVQALEAAAPCRACVGSIWRCHWCPQSSHCVYGEHCPE
GERTIYSAQEVDIQVRGPGACPQVEGLAGPHLVPVGWESHLALRVRNLQHFRGLPASFHC
WLELPGELRGLPATLEETAGDSGLIHCQAHQFYPSMSQRELPVPIYVTQGEAQRLDNTHA
LYVILYDCAMGHPDCSHCQAANRSLGCLWCADGQPACRYGPLCPPGAVELLCPAPSIDAV
EPLTGPPEGGLALTILGSNLGRAFADVQYAVSVASRPCNPEPSLYRTSARIVCVTSPAPN
GTTGPVRVAIKSQPPGISSQHFTYQDPVLLSLSPRWGPQAGGTQLTIRGQHLQTGGNTSA
FVGGQPCPILEPVCPEAIVCRTRPQAAPGEAAVLVVFGHAQRTLLASPFRYTANPQLVAA
EPSASFRGGGRLIRVRGTGLDVVQRPLLSVWLEADAEVQASRAQPQDPQPRRSCGAPAAD
PQACIQLGGGLLQCSTVCSVNSSSLLLCRSPAVPDRAHPQRVFFTLDNVQVDFASASGGQ
GFLYQPNPRLAPLSREGPARPYRLKPGHVLDVEGEGLNLGISKEEVRVHIGRGECLVKTL
TRTHLYCEPPAHAPQPANGSGLPQFVVQMGNVQLALGPVQYEAEPPLSAFPVEAQAGVGM
GAAVLIAAVLLLTLMYRHKSKQALRDYQKVLVQLESLETGVGDQCRKEFTDLMTEMTDLS
SDLEGSGIPFLDYRTYAERAFFPGHGGCPLQPKPEGPGEDGHCATVRQGLTQLSNLLNSK
LFLLTLIHTLEEQPSFSQRDRCHVASLLSLALHGKLEYLTDIMRTLLGDLAAHYVHRNPK
LMLRRTETMVEKLLTNWLSICLYAFLREVAGEPLYMLFRAIQYQVDKGPVDAVTGKAKRT
LNDSRLLREDVEFQPLTLMVLVGPGAGGAAGSSEMQRVPARVLDTDTITQVKEKVLDQVY
KGTPFSQRPSVHALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGL
VPQLHRGSTISQSLAQRCPLGENIPTLEDGEEGGVCLWHLVKATEEPEGAKVRCSSLRER
EPARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNRPIPIAVKYLFDLLDELAEKHG
IEDPGTLHIWKTNSLLLRFWVNALKNPQLIFDVRVSDNVDAILAVIAQTFIDSCTTSEHK
VGRDSPVNKLLYAREIPRYKQMVERYYADIRQSSPASYQEMNSALAELSGNYTSAPHCLE
ALQELYNHIHRYYDQIISALEEDPVGQKLQLACRLQQVAALVENKVTDL
Download sequence
Identical sequences Q9ULL4
NYSGRC-29336063 ENSP00000355378 NP_005384.2.87134 NP_005384.2.92137 ENSP00000355378 ENSP00000472730 gi|29336063|ref|NP_005384.2| 9606.ENSP00000355378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]