SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000356038 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356038
Domain Number 1 Region: 1-48
Classification Level Classification E-value
Superfamily EF-hand 0.0000000257
Family S100 proteins 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356038   Gene: ENSG00000160307   Transcript: ENST00000367071
Sequence length 94
Comment pep:putative chromosome:GRCh37:21:48018875:48025121:-1 gene:ENSG00000160307 transcript:ENST00000367071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLERWSLPMLPRLVSNF
LCSSYPPALASQSAGITGNQRAGGCGQSHGNTGQ
Download sequence
Identical sequences A0A2I3SK51 A8MRB1
ENSP00000356038 9598.ENSPTRP00000049493 ENSP00000356038 ENSP00000356038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]