SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000357067 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357067
Domain Number 1 Region: 146-341
Classification Level Classification E-value
Superfamily E set domains 1.45e-77
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000376
Further Details:      
 
Domain Number 2 Region: 38-162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.46e-23
Family Voltage-gated potassium channels 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357067   Gene: ENSG00000162728   Transcript: ENST00000368088
Sequence length 393
Comment pep:known chromosome:GRCh37:1:160051360:160060353:1 gene:ENSG00000162728 transcript:ENST00000368088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGEGAGGEAGADKEQNGCLPPPESESKV
Download sequence
Identical sequences G3RTV2 H2N556 H2Q0D9 Q92806
9600.ENSPPYP00000000751 9606.ENSP00000357067 ENSPPYP00000000751 ENSP00000357067 ENSP00000357067 ENSP00000357067 NP_004974.2.87134 NP_004974.2.92137 XP_002809970.1.23681 XP_003811940.1.60992 XP_008962540.1.60992 XP_008962541.1.60992 XP_008962542.1.60992 XP_016785749.1.37143 XP_016785755.1.37143 XP_016785760.1.37143 XP_016785765.1.37143 XP_016785773.1.37143 gi|25121970|ref|NP_004974.2| ENSPPYP00000000751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]