SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357423 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357423
Domain Number 1 Region: 2-122
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.22e-39
Family CRAL/TRIO domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357423   Gene: ENSG00000146352   Transcript: ENST00000368438
Sequence length 181
Comment pep:putative chromosome:GRCh37:6:123317834:123385612:1 gene:ENSG00000146352 transcript:ENST00000368438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWY
IHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDMGTWARTLL
DHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSL
D
Download sequence
Identical sequences A0A2J8PTR5 A0A2J8TAE5
ENSP00000357423 XP_006737289.1.47382 ENSP00000357423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]