SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000357637 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357637
Domain Number 1 Region: 254-337
Classification Level Classification E-value
Superfamily E set domains 5.42e-20
Family E-set domains of sugar-utilizing enzymes 0.09
Further Details:      
 
Weak hits

Sequence:  ENSP00000357637
Domain Number - Region: 344-394
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0157
Family HLH, helix-loop-helix DNA-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357637   Gene: ENSG00000108001   Transcript: ENST00000368648
Sequence length 551
Comment pep:known chromosome:GRCh37:10:131633547:131762105:-1 gene:ENSG00000108001 transcript:ENST00000368648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQENIPRGGTTMKEEPLGSGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPS
NLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGV
RTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDP
VIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKH
GRRARRLDPSEATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPH
AIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPG
DPERLPKEVLLKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNP
AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTS
MNGYGSGAMASLGVPGSPGFLNGSSANSPYGMKQKSAFAPVVRPQASPPPSCTSANGNGL
QAMSGLVVPPM
Download sequence
Identical sequences K7DS63
ENSP00000357637 gi|53828926|ref|NP_001005463.1| 9606.ENSP00000357637 NP_001005463.1.87134 NP_001005463.1.92137 XP_001142497.1.37143 ENSP00000357637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]