SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357727 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357727
Domain Number 1 Region: 5-96
Classification Level Classification E-value
Superfamily EF-hand 1.38e-23
Family S100 proteins 0.0000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357727   Gene: ENSG00000163220   Transcript: ENST00000368738
Sequence length 114
Comment pep:known chromosome:GRCh37:1:153330330:153333503:1 gene:ENSG00000163220 transcript:ENST00000368738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE
HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Download sequence
Identical sequences G3QEY7 P06702
9606.ENSP00000357727 ENSP00000357727 ENSP00000357727 NP_002956.1.87134 NP_002956.1.92137 XP_004026771.1.27298 gi|4506773|ref|NP_002956.1| ENSGGOP00000000844 ENSGGOP00000000844 ENSP00000357727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]