SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000357998 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357998
Domain Number 1 Region: 241-443
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.41e-31
Family Sec63 N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 101-203
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.66e-25
Family Chaperone J-domain 0.00091
Further Details:      
 
Domain Number 3 Region: 454-479,634-718
Classification Level Classification E-value
Superfamily E set domains 2.1e-24
Family Sec63 C-terminal domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357998   Gene: ENSG00000025796   Transcript: ENST00000369002
Sequence length 760
Comment pep:known chromosome:GRCh37:6:108188960:108279393:-1 gene:ENSG00000025796 transcript:ENST00000369002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQIRLKNIRKVYGRCMWYR
LRLLKPQPNIIPTVKKIVLLAGWALFLFLAYKVSKTDREYQEYNPYEVLNLDPGATVAEI
KKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALP
AWIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRN
MDMKRLIMVLAGASEFDPQYNKDATSRPTDNILIPQLIREIGSINLKKNEPPLTCPYSLK
ARVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQLIVMARNREEREFRAPTL
ASLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIQDLVSLKESDR
HTLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQVLDDEDSNNITVGSLVTVLVKLTRQTMA
EVFEKEQSICAAEEQPAEDGQGETNKNRTKGGWQQKSKGPKKTAKSKKKKPLKKKPTPVL
LPQSKQQKQKQANGVVGNEAAVKEDEEEVSDKGSDSEEEETNRDSQSEKDDGSDRDSDRE
QDEKQNKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLYFPEEKQEWWWLYIADRKE
QTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAK
PVPENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEEDDD
Download sequence
Identical sequences A0A096MVF5 A0A0S2Z5M1 A0A2K5X659 A0A2K6CX62 A0A2K6KIA0 H9FPD9 I6L5B8 Q9UGP8
HR4977 ENSP00000357998 ENSPPYP00000018910 ENSMMUP00000033296 NP_001126607.1.23681 NP_001253762.1.72884 NP_009145.1.87134 NP_009145.1.92137 XP_005552276.1.63531 XP_011734681.1.29376 XP_017734238.1.44346 gi|6005872|ref|NP_009145.1| ENSP00000357998 ENSMMUP00000021818 9544.ENSMMUP00000033296 9600.ENSPPYP00000018910 9606.ENSP00000357998 ENSP00000357998 ENSPPYP00000018910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]