SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000358159 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358159
Domain Number 1 Region: 1218-1504
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.44e-52
Family Tandem AAA-ATPase domain 0.00022
Further Details:      
 
Domain Number 2 Region: 1513-1722
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.63e-47
Family Tandem AAA-ATPase domain 0.00099
Further Details:      
 
Domain Number 3 Region: 1841-2034
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 2.48e-46
Family Sec63 N-terminal domain 0.0000724
Further Details:      
 
Domain Number 4 Region: 1007-1180
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 5.75e-45
Family Sec63 N-terminal domain 0.0018
Further Details:      
 
Domain Number 5 Region: 421-662
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.07e-42
Family Tandem AAA-ATPase domain 0.0005
Further Details:      
 
Domain Number 6 Region: 672-884
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.38e-42
Family Tandem AAA-ATPase domain 0.001
Further Details:      
 
Domain Number 7 Region: 2070-2180
Classification Level Classification E-value
Superfamily E set domains 1.06e-23
Family Sec63 C-terminal domain-like 0.00056
Further Details:      
 
Domain Number 8 Region: 885-990
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000256
Family Forkhead DNA-binding domain 0.081
Further Details:      
 
Domain Number 9 Region: 1722-1824
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000019
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358159   Gene: ENSG00000112249   Transcript: ENST00000369162
Sequence length 2202
Comment pep:known chromosome:GRCh37:6:100956070:101329240:-1 gene:ENSG00000112249 transcript:ENST00000369162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEK
SKMQSINEDLKDILHAAKQIVGTDNGREAIESGAAFLFMTFHLKDSVGHKETKAIKQMFG
PFPSSSATAACNATNRIISHFSQDDLTALVQMTEKEHGDRVFFGKNLAFSFDMHDLDHFD
ELPINGETQKTISLDYKKFLNEHLQEACTPELKPVEKTNGSFLWCEVEKYLNSTLKEMTE
VPRVEDLCCTLYDMLASIKSGDELQDELFELLGPEGLELIEKLLQNRITIVDRFLNSSND
HRFQALQDNCKKILGENAKPNYGCQVTIQSEQEKQLMKQYRREEKRIARREKKAGEDLEV
SEGLMCFDPKELRIQREQALLNARSVPILSRQRDADVEKIHYPHVYDSQAEAMKTSAFIA
GAKMILPEGIQRENNKLYEEVRIPYSEPMPLSFEEKPVYIQDLDEIGQLAFKGMKRLNRI
QSIVFETAYNTNENMLICAPTGAGKTNIAMLTVLHEIRQHFQQGVIKKNEFKIVYVAPMK
ALAAEMTDYFSRRLEPLGIIVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGDVA
LSQIVRLLILDEVHLLHEDRGPVLESIVARTLRQVESTQSMIRILGLSATLPNYLDVATF
LHVNPYIGLFFFDGRFRPVPLGQTFLGIKCANKMQQLNNMDEVCYENVLKQVKAGHQVMV
FVHARNATVRTAMSLIERAKNCGHIPFFFPTQGHDYVLAEKQVQRSRNKQVRELFPDGFS
IHHAGMLRQDRNLVENLFSNGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYAAKRGSFVD
LGILDVMQIFGRAGRPQFDKFGEGIIITTHDKLSHYLTLLTQRNPIESQFLESLADNLNA
EIALGTVTNVEEAVKWISYTYLYVRMRANPLAYGISHKAYQIDPTLRKHREQLVIEVGRK
LDKAQMIRFEERTGYFSSTDLGRTASHYYIKYNTIETFNELFDAHKTEGDIFAIVSKAEE
FDQIKVREEEIEELDTLLSNFCELSTPGGVENSYGKINILLQTYISRGEMDSFSLISDSA
YVAQNAARIVRALFEIALRKRWPTMTYRLLNLSKVIDKRLWGWASPLRQFSILPPHILTR
LEEKKLTVDKLKDMRKDEIGHILHHVNIGLKVKQCVHQIPSVMMEASIQPITRTVLRVTL
SIYADFTWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFLALKKQVISKEAQLLVFTIPIF
EPLPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPITALGCKAYEA
LYNFSHFNPVQTQIFHTLYHTDCNVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIAP
LKALVRERMDDWKVRIEEKLGKKVIELTGDVTPDMKSIAKADLIVTTPEKWDGVSRSWQN
RNYVQQVTILIIDEIHLLGEERGPVLEVIVSRTNFISSHTEKPVRIVGLSTALANARDLA
DWLNIKQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPAFQAIRSHSPAKPVLI
FVSSRRQTRLTALELIAFLATEEDPKQWLNMDEREMENIIATVRDSNLKLTLAFGIGMHH
AGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVIIKGTEYYDGKTRRYVDFPI
TDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLGVLSDHLNAEIA
GGTITSKQDALDYITWTYFFRRLIMNPSYYNLGDVSHDSVNKFLSHLIEKSLIELELSYC
IEIGEDNRSIEPLTYGRIASYYYLKHQTVKMFKDRLKPECSTEELLSILSDAEEYTDLPV
RHNEDHMNSELAKCLPIESNPHSFDSPHTKAHLLLQAHLSRAMLPCPDYDTDTKTVLDQA
LRVCQAMLDVAANQGWLVTVLNITNLIQMVIQGRWLKDSSLLTLPNIENHHLHLFKKWKP
IMKGPHARGRTSIESLPELIHACGGKDHVFSSMVESELHAAKTKQAWNFLSHLPVINVGI
SVKGSWDDLVEGHNELSVSTLTADKRDDNKWIKLHADQEYVLQVSLQRVHFGFHKGKPES
CAVTPRFPKSKDEGWFLILGEVDKRELIALKRVGYIRNHHVASLSFYTPEIPGRYIYTLY
FMSDCYLGLDQQYDIYLNVTQASLSAQVNTKVSDSLTDLALK
Download sequence
Identical sequences Q8N3C0
gi|76880486|ref|NP_006819.2| NP_006819.2.87134 NP_006819.2.92137 ENSP00000358159 ENSP00000320777 ENSP00000358159 9606.ENSP00000320252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]