SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000358323 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358323
Domain Number 1 Region: 3-161
Classification Level Classification E-value
Superfamily E set domains 2.52e-18
Family Arrestin/Vps26-like 0.029
Further Details:      
 
Domain Number 2 Region: 159-336
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000455
Family Arrestin/Vps26-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358323   Gene: ENSG00000117289   Transcript: ENST00000369317
Sequence length 391
Comment pep:known chromosome:GRCh37:1:145438469:145442635:1 gene:ENSG00000117289 transcript:ENST00000369317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGS
QQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGC
VDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSV
SARIDRKGFCEGDEISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGN
HIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRS
GLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQD
SPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ
Download sequence
Identical sequences A0A024R4B7 G2HH02 Q9H3M7
9606.ENSP00000358323 ENSP00000462521 NP_001258601.1.37143 NP_006463.3.87134 NP_006463.3.92137 ENSP00000358323 ENSP00000462521 gi|171184421|ref|NP_006463.3| ENSP00000358323 ENSP00000462521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]