SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000358473 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358473
Domain Number 1 Region: 340-440
Classification Level Classification E-value
Superfamily E set domains 1.47e-26
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 128-186
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000421
Family B-box zinc-binding domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSP00000358473
Domain Number - Region: 168-270
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000641
Family Apolipoprotein 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358473   Gene: ENSG00000134253   Transcript: ENST00000369461
Sequence length 523
Comment pep:putative chromosome:GRCh37:1:117654807:117665209:-1 gene:ENSG00000134253 transcript:ENST00000369461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGVTLEGGGARSGEGRRSRTELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLA
VNDVMLESLRGEGQGLVCDLCNDREVEKRCQTCKANLCHFCCQAHRRQKKTTYHTMVDLK
DLKGYSRIGKPILCPVHPAEELRLFCEFCDRPVCQDCVVGEHREHPCDFTSNVIHKHGDS
VWELLKGTQPHVEALEEALAQIHIINSALQKRVEAVAADVRTFSEGYIKAIEEHRDKLLK
QLEDIRAQKENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILITKRVVVERLRKL
NKVQYSTRPGVNDKIRFCPQEKAGQCRGYEIYGTINTKEVDPAKCVLQGEDLHRAREKQT
ASFTLLCKDAAGEIMGRGGDNVQVAVVPKDKKDSPVRTMVQDNKDGTYYISYTPKEPGVY
TVWVCIKEQHVQGSPFTVMVRRKHRPHSGVFHCCTFCSSGGQKTARCACGGTMPGGYLGC
GHGHKGHPGHPHWSCCGKFNEKSECTWTGGQSAPRSLLRTVAL
Download sequence
Identical sequences Q5T2K3
ENSP00000358473 ENSP00000358473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]