SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000358476 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358476
Domain Number 1 Region: 391-497
Classification Level Classification E-value
Superfamily E set domains 1.4e-25
Family Filamin repeat (rod domain) 0.0023
Further Details:      
 
Domain Number 2 Region: 185-243
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000458
Family B-box zinc-binding domain 0.0033
Further Details:      
 
Domain Number 3 Region: 26-59,94-102
Classification Level Classification E-value
Superfamily RING/U-box 0.000000386
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSP00000358476
Domain Number - Region: 225-327
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000719
Family Apolipoprotein 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358476   Gene: ENSG00000134253   Transcript: ENST00000369464
Sequence length 562
Comment pep:known chromosome:GRCh37:1:117653682:117664384:-1 gene:ENSG00000134253 transcript:ENST00000369464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSENRKPLLGFVSKLTSGTALGNSGKTHCPLCLGLFKAPRLLPCLHTVCTTCLEQLEPFS
VVDIRGGDSDTSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVND
VMLESLRGEGQGLVCDLCNDREVEKRCQTCKANLCHFCCQAHRRQKKTTYHTMVDLKDLK
GYSRIGKPILCPVHPAEELRLFCEFCDRPVCQDCVVGEHREHPCDFTSNVIHKHGDSVWE
LLKGTQPHVEALEEALAQIHIINSALQKRVEAVAADVRTFSEGYIKAIEEHRDKLLKQLE
DIRAQKENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILITKRVVVERLRKLNKV
QYSTRPGVNDKIRFCPQEKAGQCRGYEIYDLHRAREKQTASFTLLCKDAAGEIMGRGGDN
VQVAVVPKDKKDSPVRTMVQDNKDGTYYISYTPKEPGVYTVWVCIKEQHVQGSPFTVMVR
RKHRPHSGVFHCCTFCSSGGQKTARCACGGTMPGGYLGCGHGHKGHPGHPHWSCCGKFNE
KSECTWTGGQSAPRSLLRTVAL
Download sequence
Identical sequences gi|224548923|ref|NP_001139107.1| ENSP00000358476 NP_001139107.1.87134 NP_001139107.1.92137 ENSP00000358476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]